PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cla019705
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Citrullus
Family Dof
Protein Properties Length: 302aa    MW: 33558.4 Da    PI: 7.4625
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cla019705genomeICuGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.82.7e-392483261
     zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
               ++++l+cprCds+ntkfCyynnyslsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+ 
  Cla019705 24 HQEQLRCPRCDSSNTKFCYYNNYSLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRL 83
               7899******************************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027011.3E-332682IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.462882IPR003851Zinc finger, Dof-type
ProDomPD0074785.0E-272882IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103066IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MDDNNNNKQL PTSQDQKTQQ KQQHQEQLRC PRCDSSNTKF CYYNNYSLSQ PRHFCKACKR  60
YWTRGGTLRN VPVGGGCRKN KRLKRPTTAS TTITHSSSSP APTAPDSTSS SSTSCNTNPL  120
HNIFYGPTSD LNLPFSGYDH HHHHHLQTHL NAIGLGFSSP NIDHRDFNLN GFNSSSLLSG  180
YSSLFGNNNN NPSSNSTSIS SLLASKFDPN LFGNLANSQP FDDHVMGSNG GDQLGLNVKD  240
VKLEDGMKRL NWEDDDQQQN HQTDEIVAQS NDHNSLFGNN WASQNWHHDP PNLASSITSS  300
LI
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819320.0LN681932.1 Cucumis melo genomic scaffold, anchoredscaffold00001.
GenBankLN7132660.0LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008442739.11e-152PREDICTED: dof zinc finger protein DOF1.4-like
TrEMBLA0A0A0LV581e-149A0A0A0LV58_CUCSA; Uncharacterized protein
STRINGPOPTR_0011s05450.12e-59(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45223356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.21e-34Dof family protein